PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28644.m000915
Common NameLOC8281407, RCOM_0297030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 168aa    MW: 19402.4 Da    PI: 5.5865
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28644.m000915genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY92.82.6e-29107165159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +dDgy+WrKYG+K vk+s++pr+Y++C  agC+vkk v+r++edp++v++tYeg Hnhe
  28644.m000915 107 MDDGYRWRKYGKKAVKNSRNPRNYFKCLKAGCNVKKTVQRDTEDPDYVTTTYEGMHNHE 165
                    59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.8E-3193166IPR003657WRKY domain
SuperFamilySSF1182903.79E-26100165IPR003657WRKY domain
PROSITE profilePS5081127.508102167IPR003657WRKY domain
SMARTSM007748.4E-31107166IPR003657WRKY domain
PfamPF031061.5E-23108165IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MSDSNCSSFL EANTPHNPNN FNHLDNYETE TDIIDHENFE PFDLMVAEEL ESDFTSILAE  60
LQQEITTNNT ILSTPDVPRR HESGGKGVKI DERKRIAFRT KSGIDIMDDG YRWRKYGKKA  120
VKNSRNPRNY FKCLKAGCNV KKTVQRDTED PDYVTTTYEG MHNHEALH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-2397165775Probable WRKY transcription factor 4
1wj2_A2e-2397165775Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002527106.11e-125PREDICTED: probable WRKY transcription factor 75
SwissprotQ93WU91e-33WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLB9SM871e-125B9SM87_RICCO; WRKY transcription factor, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112034110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.18e-35WRKY DNA-binding protein 51